PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC046361.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 728aa    MW: 80096.5 Da    PI: 6.8985
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC046361.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.3e-094695061954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  EcC046361.10 469 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 506
                   554459******************************88 PP

2BELL119.81.2e-38330401172
          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   e++elqk+k+kLls+l+eVd+rY++y++q+++v+ssFeavag g+a++Y +lA+ka+SrhFrcL+d i++qi
  EcC046361.10 330 EFMELQKRKTKLLSMLDEVDRRYRHYCDQMKAVVSSFEAVAGSGAATVYSALASKAMSRHFRCLRDGIVGQI 401
                   679*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.5E-65263399IPR006563POX domain
PfamPF075261.8E-49269397IPR006563POX domain
PROSITE profilePS5007112.163447510IPR001356Homeobox domain
CDDcd000864.05E-12450511No hitNo description
SMARTSM003895.8E-9450514IPR001356Homeobox domain
SuperFamilySSF466894.28E-17451518IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-28453517IPR009057Homeodomain-like
PfamPF059201.0E-17467506IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MPMRSEEKSS GMVVSSSSTG GFCYSDLSSS HNPAIQAQPH LVSQIPSYDS GSEIFNLASG  60
MDMIGFPKDG LQSHPPQNHV AATSALLWKG NDFFAKTVSP NNNNQSGPSS SKTVAAAGLD  120
DSAASEFYRH EFNKTDFVPA NQNLMTAAAT TSQDESTWQE SNKLVVDDSS IRCVFPCEGN  180
ERPSQGLSLS LSSANPSSIG LQSFELRHTN TSGGGGGHHS DHHQHQGDMR LFAASTSKEG  240
FFGKSHLGGH IHPQQAMMMM HQQAGQFQLR NSKYLGPAQE LLNEFCSLGA KQSDLLKHQK  300
PNKSKAYDDQ DGDNGGPSGS SKQQSLGSLE FMELQKRKTK LLSMLDEVDR RYRHYCDQMK  360
AVVSSFEAVA GSGAATVYSA LASKAMSRHF RCLRDGIVGQ IQATKKAMGE KDLASPGTTR  420
GETPRLKIID QALRQQRAFQ QMTMMDNHPW RPQRGLPERS VSVLRAWLFE HFLHPYPSDV  480
DKHILARQTG LSRSQVSNWF INARVRLWKP MVEEMYMEET REHDNMGSSD GAADLEDDGR  540
PNNHNREATR VEDQKPTSDQ LVRIDSECFS SIVTSPDKSD QHHHSKMAAT RAPQNHHHHH  600
HHHHHLHPQN SGFGRVSDAY GGMEIDFSSY NHHPVTSAAP YSNDGDASHQ NFNGSGGGVS  660
LTLGLQQHGG PSHGVSLAFS SVSQNSLFYP RDHIEDCHPV QYSLLDGEGQ TLPYRNLMGA  720
QLLHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B5e-16456513158Homeobox protein Meis1
4xrs_A5e-16456513158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053224.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_010053225.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-146BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A059CGZ00.0A0A059CGZ0_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58662639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-130TALE family protein